PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN22628.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 348aa    MW: 38762.9 Da    PI: 8.9245
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN22628.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.93.9e-53151421128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ +++
  PIN22628.1  15 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-AIIAEVDLYKFDPWELPAKAIFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTAgGTQ 112
                 79****************************.88***************7777899**************************************997778 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +vg+kk Lvfy g+ pkg kt+W+mheyrl
  PIN22628.1 113 KVGVKKALVFYGGKPPKGIKTSWIMHEYRL 142
                 8***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    
MESTDSSGGS QQPQLPPGFR FHPTDEELVV HYLKKKAASA PLPVAIIAEV DLYKFDPWEL  60
PAKAIFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPVLTAGG TQKVGVKKAL  120
VFYGGKPPKG IKTSWIMHEY RLADNKPVNN KPPGCDVANK KGSLRLDDWV LCRIYKKNNA  180
QRPMDLERDD INDMIGPIQP TIPMPIVQQQ KLKASNYSSV LEHDHNLYKG LIGNDSINSH  240
LVSSGSKPPH LPFMTADTNL LPSKRPLPTL YWNEEEGNPN SPPTKRFLVE GCDDSIGRTD  300
ETTNSIATIL GHLPQTPNSM QQQGMIGSIG DGVFKQQQYQ VSGMNWYT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-124NAC family protein