PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN22627.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 339aa    MW: 38266.1 Da    PI: 9.2704
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN22627.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.3e-52161411128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrF Ptdeel+v+yL+kkv+g++++l ++i ++d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++
  PIN22627.1  16 LPPGFRFYPTDEELLVQYLCKKVAGHHFSL-QIIGDIDLYKFDPWDLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRK 112
                 79***************************9.89***************7777799***********************************9999.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfy g+apkg+kt+W+mheyrl
  PIN22627.1 113 VGIKKALVFYVGKAPKGTKTNWIMHEYRL 141
                 ***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    
MKMGIRETDP LSQLSLPPGF RFYPTDEELL VQYLCKKVAG HHFSLQIIGD IDLYKFDPWD  60
LPSKAIFGEK EWYFFSPRDR KYPNGSRPNR VAGSGYWKAT GTDKIITTEG RKVGIKKALV  120
FYVGKAPKGT KTNWIMHEYR LSEPSRKNGS VRLDDWVLCR IYKKNSSAQK PTISGVQSKE  180
YSLGSSSSSS SQYDDVLESL PEIDDRFFSL PRMNSLKNIK QEDQKLNLQQ LGSGNFDWAT  240
LAGLHPLPEL GPPQPGLTQQ PQMNNNNMNG QNDIYAPSLQ HLGGNVMDEE VQSGLRAQRG  300
DRPGFFPQNV GMYSHDFSNS IDPFSVRYPT QPGGLGFRQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-129NAC family protein