PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN20895.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 325aa    MW: 37019.7 Da    PI: 8.3361
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN20895.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.12e-54151441128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPtdeel+ +yL+kkv+ ++++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++ ++
  PIN20895.1  15 VPPGFRFHPTDEELLYYYLRKKVSYEPIDL-DVIREVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIHLSN 112
                 69****************************.9***************952444443456**************************************** PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++ +g++ktLvfy+grap+g+ktdW+mheyrl
  PIN20895.1 113 SKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 144
                 ******************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    
MKNQNMMGGN GQLSVPPGFR FHPTDEELLY YYLRKKVSYE PIDLDVIREV DLNKLEPWDL  60
KEKCRIGSGP QNEWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAIHL SNSKRIGMRK  120
TLVFYTGRAP HGQKTDWIMH EYRLDDDSAP HEIQEDGWVV CRVFKKKNHT RGYHPDVDQE  180
EPLIPFNAVG VCAPDPKLNS NHPHYNGLRF DQHSSIHLPQ LLSPESTVPP AFFSSLPLDL  240
HSPQNLLRLT SAAAGPSSAA VSGFAQHEKL SGDWSFLDKL LATHQTMDNI SKCHQFSQVA  300
DLVPPGQRFP FSYHGFDPDF SKFSK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.11e-106NAC family protein