PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN20729.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 236aa    MW: 26868.1 Da    PI: 4.9509
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN20729.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.71.4e-4641351128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                 lp GfrF Pt+eel+++yL++k+e+k++++++vi+ vdiy+++PwdLpk     +++++++w+fF++r++++ +g r++r+t+sgyWkatg+   v+s+
  PIN20729.1   4 LPTGFRFYPTEEELISFYLHNKLEDKSTNINRVIPIVDIYQLDPWDLPKqcgeLCNGDTEQWFFFTPRQEREVRGGRPSRTTASGYWKATGSPSYVFSS 102
                 699***************************99****************645643444777*************************************** PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                 +++++g+kk++vfykg+ap+g+kt+W m+eyr+
  PIN20729.1 103 DNKVIGVKKSMVFYKGKAPTGRKTKWKMNEYRA 135
                 *******************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    
MEELPTGFRF YPTEEELISF YLHNKLEDKS TNINRVIPIV DIYQLDPWDL PKQCGELCNG  60
DTEQWFFFTP RQEREVRGGR PSRTTASGYW KATGSPSYVF SSDNKVIGVK KSMVFYKGKA  120
PTGRKTKWKM NEYRAIKEDS QTSAPKLMNE LSLCRVYIVS GSCRAFDRRP VYIGESSSSR  180
EVKITQENGE GIVGNSGMLL ERRGSSESLA SGENYDVENV GETADGLENL MEWEDF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.18e-87NAC family protein