PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN19741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 304aa    MW: 34366.6 Da    PI: 9.4313
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN19741.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.6e-53151421128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeelvv+yLkkk+++++l++  vi+e+d+yk++Pw+Lp+k++ +e+ewyfFs+r++ky++g+r+nra++sgyWkatg+dk++l++ +++
  PIN19741.1  15 LPPGFRFHPTDEELVVHYLKKKAAADPLPV-AVIAEIDLYKYDPWELPSKASFGEQEWYFFSPRERKYPNGERPNRAATSGYWKATGTDKPILTAeGNR 112
                 79****************************.89***************988899**************************************9986788 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 ++g+kk Lvfy g+ pkg kt+W+mheyrl
  PIN19741.1 113 KIGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                 9***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    
MESTSSSGGI HHPRLPPGFR FHPTDEELVV HYLKKKAAAD PLPVAVIAEI DLYKYDPWEL  60
PSKASFGEQE WYFFSPRERK YPNGERPNRA ATSGYWKATG TDKPILTAEG NRKIGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLVENSSSRN ANRPPGITLR KKRSLQLDDW VLCRIFKKIN  180
STSQPIDHES MADVPISRPI SSTDPNLFPQ MQSGNGWLNP HNIPMSISDP FQSSSKSYWN  240
GVPSNRAIIS SDSKQCEAEE DDYNPGGRNI SFISLLNQQY YPQEFGQSYL GNHGLLPQSY  300
SFSK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.17e-97NAC family protein