PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN17593.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 315aa    MW: 36317.5 Da    PI: 8.7281
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN17593.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.5e-55171431129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeel+++yL kkv + ++++  +i evd++kvePw+Lp ++k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkdke+++ +++l
  PIN17593.1  17 LPPGFRFHPTDEELITHYLSKKVLDPSFSA-VAIGEVDMNKVEPWELPWRAKVGEKEWYFFCVRDKKYPTGLRTNRATAKGYWKATGKDKEIFR-GKTL 113
                 79*************************999.67***************988999****************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                 vg+kktLvfykgrapkgekt+Wv+heyrle
  PIN17593.1 114 VGMKKTLVFYKGRAPKGEKTNWVIHEYRLE 143
                 ****************************85 PP

Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    
MEKNSFGVVK RDDQMELPPG FRFHPTDEEL ITHYLSKKVL DPSFSAVAIG EVDMNKVEPW  60
ELPWRAKVGE KEWYFFCVRD KKYPTGLRTN RATAKGYWKA TGKDKEIFRG KTLVGMKKTL  120
VFYKGRAPKG EKTNWVIHEY RLEGKFSLQN LPKQVKPNDW VMIRVFHKTS GGKKFHISEL  180
KRMTLEENIS SPSTMPPLMD PSPTNDKIKH VEVEPKPKPE PESSQVHCSS KPITAPEKNH  240
ENLITFFDDP IFPSFPIDPF FKNLNENYEQ NMNQGFRKEK KMVSLSQEVG TIAFEEQEAA  300
ASSVGVEDLD CIWSN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.11e-110NAC family protein