PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN17395.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 368aa    MW: 41524.3 Da    PI: 8.7446
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN17395.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.53.3e-50331582128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++ + +
  PIN17395.1  33 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSENLRSI 130
                 79***************************.89***************8778899********************************************* PP

         NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                 glkktLvfy+g+apkg +t+W+m+eyrl
  PIN17395.1 131 GLKKTLVFYSGKAPKGIRTSWIMNEYRL 158
                 **************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    
MAIAASMNNN QEVDSSNKKQ LDGDDEHEYD MVMPGFRFHP TEEELVEFYL RRKVEGKRFN  60
VELITFLDLY RYDPWELPAL AAIGEKEWYF YVPRDRKYRN GDRPNRVTTS GYWKATGADR  120
MIRSENLRSI GLKKTLVFYS GKAPKGIRTS WIMNEYRLPL HETERLQKAE ISLCRVYKRA  180
GVEDHPSLPR SLPTRASSSR SASRNQTTYG SNASHRSDGS GKLTETSPTS SNSYSLNPIL  240
PIASPTIIPS PTSGQEDSHT MIMSQSKQPS NSSLSPTIFA SSSSSSSHAI DDLHKLVNIN  300
YSQQVSILSN QDINPHYPSN NIVLSQFSSP LQPTTTVGLG SFHAAFSDRL WDWSGISDAN  360
KDFYNLFK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-107NAC family protein