PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN17155.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 365aa    MW: 41213 Da    PI: 6.6638
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN17155.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.14.7e-42151321128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 + pGfrFhPtdeel           k+l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ +++
  PIN17155.1  15 MLPGFRFHPTDEELQ----------KPLSI-ELIKQLDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSeGSK 102
                 579**********97..........77778.78***************8888999***************************************95667 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +glkk+Lvfykgra kg+ktdW+mhe+r+
  PIN17155.1 103 CIGLKKSLVFYKGRAGKGVKTDWMMHEFRF 132
                 7***************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    
MEGKNHECDK IDEVMLPGFR FHPTDEELQK PLSIELIKQL DIYKYDPWDL PKLATTGEKE  60
WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSEG SKCIGLKKSL VFYKGRAGKG  120
VKTDWMMHEF RFPSDTVSSK KYLDKNIPAN EAWAICRIFK KVNSTAQRAL SHSWINSPIF  180
DTNTSDIMNP INAYNNIHFS SSSITMANKT NSPLHFGFNR NNDMEQSSIA SFCMGNKPFP  240
LSVSNEDHLT NPSHTFSSCD QTTSKCAIND ASSLLQEMST SILGDFGKNV DFSVLQEQCT  300
EGMEGNLGHG EQNVGQVDDD QWAKFGHSFN PLSSLGDAWK SNLLWDSSSC PSELYTSYST  360
NKCYS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-100NAC family protein