PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN17104.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 224aa    MW: 25442.9 Da    PI: 5.6525
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN17104.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM107.51.6e-3361273128
         NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyat.gkrknratksgyWkatgkdkevlskk 96 
                 +GfrFhPt+eel+        +g++ ++++ +  + i++++Pw+ p+    +++++ ++w+fF++r++++a+ g r+nr tk+gyWkatg+  ev+s++
  PIN17104.1   6 VGFRFHPTEEELL--------KGQH-QTSTGLYLLSIFNYNPWERPQlageRCQGDAEQWFFFIPRQEREARgGIRPNRLTKEGYWKATGSPGEVYSSQ 95 
                 7***********9........3333.2334588899*******998556667777889********999997478************************ PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++ +g kkt+vfy+grap+g+kt+W m+ey++
  PIN17104.1  96 NQRIGSKKTMVFYEGRAPNGRKTSWKMNEYKV 127
                 ******************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    
MNDLGVGFRF HPTEEELLKG QHQTSTGLYL LSIFNYNPWE RPQLAGERCQ GDAEQWFFFI  60
PRQEREARGG IRPNRLTKEG YWKATGSPGE VYSSQNQRIG SKKTMVFYEG RAPNGRKTSW  120
KMNEYKVFDD YDHDHGGADL KVREEPSLCR IYRRSKCSSA FDRQPPTGDE MAVHQPQNHA  180
DEPITTNNQQ INPPEIIDGG VDSSSSGDQN TNPSQSVENE TVGI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.23e-61NAC family protein