PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN14718.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 389aa    MW: 44312.1 Da    PI: 6.8594
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN14718.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM45.82e-141461149
         NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                lppGfr+hPtdeel+ +yL++k+ +k+ ++ +vi e+d+yk+ P++Lp+
  PIN14718.1 14 LPPGFRYHPTDEELLFYYLTRKIYSKRYRI-DVIGETDVYKWGPKELPE 61
                79****************************.99**************94 PP

Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    
MNVDVDSFGN GDILPPGFRY HPTDEELLFY YLTRKIYSKR YRIDVIGETD VYKWGPKELP  60
EIASIPPSDY TELPSCPHCL ERLDPYTSGI QSTLCDHSFR CSCVSKWTYL SCPVCRLCQQ  120
PDEKPACVVC GSFKNIWVCL ICGFVGCGRY EKGHASGHWS GTQHHFSLEL QKQQIWDFVG  180
DKCVHRLNQS RADGKSVVAN SRCSSAEECE TCGYEEAEGL DGALFSSKIE GTLDEYNRLL  240
ASQLDIHRQH YELLLAEARS GKESSTAKAV EKAIFSKTHE LEYKLEKCAD EKKAVADRNQ  300
ELMKKQEFLQ NKFKEIEERE RSLLKSKDEQ ISDLQEQIRD LKVYVEVQRM VTNMGDSNGI  360
KGGTILPVEK NQLSSGNSKR RSKSGRRRN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.12e-15NAC family protein