PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN11301.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 229aa    MW: 25960.3 Da    PI: 8.9333
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN11301.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.4e-52141381128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+evd++k++PwdLp     +e+e yfFs+r+ ky++g+r+nrat sgyWkatg dk+++s+ +++
  PIN11301.1  14 LPPGFRFHPTDEELVVQYLKRKVLSCPLPA-SIIPEVDVCKSDPWDLP---GDSEQERYFFSTREVKYPNGNRSNRATGSGYWKATGLDKQIVSSrSNQ 108
                 79****************************.89***************...3467899***********************************985667 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  vg+kktLvfy+g+ pkg +tdWvmheyrl
  PIN11301.1 109 IVGMKKTLVFYRGKPPKGCRTDWVMHEYRL 138
                 7***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    
MEKLSLAKNG VLRLPPGFRF HPTDEELVVQ YLKRKVLSCP LPASIIPEVD VCKSDPWDLP  60
GDSEQERYFF STREVKYPNG NRSNRATGSG YWKATGLDKQ IVSSRSNQIV GMKKTLVFYR  120
GKPPKGCRTD WVMHEYRLIT AKNLPQENWV LCRIFFKRRN NKIDDHEGAV IQNRSGEPGS  180
VPVFYDFMAK ERADLNLLPA NSSSGSSGIT EISNRKDSDD HEESSSCNS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-102NAC family protein