PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN10774.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 336aa    MW: 39389.1 Da    PI: 6.151
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN10774.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.35e-5671361129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPtdeelv++yL++k+++++++l +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s k
  PIN10774.1   7 VPPGFRFHPTDEELVDYYLRRKITSRRIDL-DVIKDVDLYKIEPWDLQElcRIGTeEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS-K 103
                 69****************************.9***************954555442556**************************************.8 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                 + l+g++ktLvfykgrap+g+k+dW+mheyrle
  PIN10774.1 104 HDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                 899****************************85 PP

Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    
MNTFSHVPPG FRFHPTDEEL VDYYLRRKIT SRRIDLDVIK DVDLYKIEPW DLQELCRIGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GTPQASEEGW VVCRVFKKRI ATMRRLSEHD SPIWYDDQVS  180
FMPDIDSPQQ HSHHNLPYHY PYNTSCKKEM DLQYSIPPDH FLQLPLLESP KMLHPQTSNN  240
INPMPSYSGL NLNPATNIMN SQEHIPQPLD HNFNSMSADQ VTDWRVLDKF VASQLSQDEI  300
SKENEAFEES NIIGRNLNKQ EMAEENASSC QIDLWK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-128NAC family protein