PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN09961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 406aa    MW: 46492.5 Da    PI: 5.2052
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN09961.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-53251521128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeel+++yL+ kv + +++    i+evd++++ePw+Lp ++k +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd+ev+s+ +g 
  PIN09961.1  25 LPPGFRFHPTDEELITFYLASKVFNGTFSG-VEIAEVDLNRCEPWQLPDAAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATGKDREVYSAsSGG 122
                 79*************************999.45***************8888999**************************************987788 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 l g+kktLvfykgrap+gekt+Wvmheyrl
  PIN09961.1 123 LLGMKKTLVFYKGRAPRGEKTKWVMHEYRL 152
                 9***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    
MMMGMEEEIL CELEERDDEM NERGLPPGFR FHPTDEELIT FYLASKVFNG TFSGVEIAEV  60
DLNRCEPWQL PDAAKMGERE WYFFSLRDRK YPTGLRTNRA TGAGYWKATG KDREVYSASS  120
GGLLGMKKTL VFYKGRAPRG EKTKWVMHEY RLDGDFSCRH TAKEEWVICR IFHKIGEKKT  180
PTMLQEQSYL LKPSPFSTTT TNSNSLPPLL EPPPTLLETQ SQNQDYRHPP IMQITLNQNQ  240
NSFLVHTQEY SHDFKTLINP LVDPFLVNNS NLSSFTNKDS NILLKPFLSH EYQDLTTFKE  300
LSNAIAKQCK KEPNILQPPD VQIRSSTDGF GTMNMNMNMQ YWAERKIQDN SKYDQNPFLF  360
GSSGAADEMG IPSGTLVEGV DNINVNAIDA ADVDHVMSTE PAFKWW
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.14e-98NAC family protein