PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN09385.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 323aa    MW: 36622.1 Da    PI: 8.4181
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN09385.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.73.6e-43710531129
         NAM  31 eevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                 +++i+e+d +k+ePwdLpkk+k +ekew+fF++rd+ky+tg r+nrat+sgyWkatgkdke+++ ++ lvg+kktLvfykgrapkgekt+Wvmheyrle
  PIN09385.1   7 AKAITEADFNKCEPWDLPKKAKMGEKEWFFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIYKGRNILVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 105
                 367***************99999*****************************************9999*****************************85 PP

Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    
MDRRFVAKAI TEADFNKCEP WDLPKKAKMG EKEWFFFCQR DRKYPTGMRT NRATESGYWK  60
ATGKDKEIYK GRNILVGMKK TLVFYKGRAP KGEKTNWVMH EYRLEGNFSN YNFSRASKEE  120
WVVCRVFHKN TGIRRSPGVE LARIDSFVDH LLDSPTLPPL TDYTLPSSGF PTYGEDESKP  180
NIIPSSRLIL NAQNYPPNTT NSFSTPQITL PTSMFPYQPS SSRDYHHQNG LSSIISTFPT  240
SAFPLKIAHE ANVTPKMELF SSNNSVNVSH SQDTGLSTEN VANEITSVHS NAEIGSKKPF  300
DQELDGLGFS PDISDLDSLW SNY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.13e-79NAC family protein