PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN06913.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 177aa    MW: 20617.6 Da    PI: 9.6932
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN06913.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM132.82.5e-41141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lp Gf F Ptd e++ +yL kk+++++l++   +++v++y+++P++L +++ ++   wyfF++r++ky++g+r+nra+ +gyWka+gk++++l+ ++++
  PIN06913.1  14 LPLGFVFAPTDLEVIRDYLIKKIKNEPLPA-PLVHDVNLYQYNPETLAESYPEHVYGWYFFTPRERKYKNGSRPNRAAGTGYWKASGKEEPILA-GRTV 110
                 699*************************99.78**************977777888**************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 +g k+tL+fy+g+ p+g kt+W+m+e+++
  PIN06913.1 111 IGRKRTLAFYQGNYPNGDKTEWLMQEFTI 139
                 ***************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    
MAEDNPAAAL LADLPLGFVF APTDLEVIRD YLIKKIKNEP LPAPLVHDVN LYQYNPETLA  60
ESYPEHVYGW YFFTPRERKY KNGSRPNRAA GTGYWKASGK EEPILAGRTV IGRKRTLAFY  120
QGNYPNGDKT EWLMQEFTIA GPQPLRRDEN DMRLDDWVLC RIYKSHIKVR ENKKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.12e-50NAC family protein