PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN06912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 534aa    MW: 59365.2 Da    PI: 4.2753
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN06912.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM139.71.8e-43161442128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                 ppG+rF Ptd el+ +yL kkv++++l+l + i +v++y+++P++L  +  k ++++wyfF++r+kky++g+r++r++ +gyWkatg dk++l +  + 
  PIN06912.1  16 PPGVRFAPTDLELIYHYLMKKVNNQPLPL-DEIYDVNLYQYNPETLAeSYPKLGDNDWYFFTPREKKYKNGSRPKRSAGTGYWKATGADKPILLRnhTI 113
                 9****************************.77**************8456666999*************************************984344 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g k+ Lvfy+g++pkg+ktdW+m e+++
  PIN06912.1 114 TTIGWKRALVFYQGKSPKGNKTDWMMYEFKV 144
                 45***************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    
MAAELNPATL LSRRFPPGVR FAPTDLELIY HYLMKKVNNQ PLPLDEIYDV NLYQYNPETL  60
AESYPKLGDN DWYFFTPREK KYKNGSRPKR SAGTGYWKAT GADKPILLRN HTITTIGWKR  120
ALVFYQGKSP KGNKTDWMMY EFKVDQPQPS RNKRGGDGMR LDDWVLCRIY KKANRSRENS  180
QQAAEASPLE DSPPVDQNNS PEFIEADDPE VDNNENLAQI ENTVATLDSP EVGNNNTNNN  240
LGPIVIHDDN ATQVGANSYD INGVPLVPSI SEQADWIVQD LANFSIDPPS QNALPQNVPE  300
ASSYHINFGF DGVTNSFEQP QNVPESLFFG EGWGIQKGDF QVQECFLETQ YSTNPPQMGH  360
SLFGPSTSNL SESKIGIEDY DKDGVTNSFA QAQHVSEPSF FDMAGCGFQE GDFQFQEGFN  420
WKTLYSTDPP QTEPSHFGPS TSNLSKSKIE LEDYDKDGVT NPFAQPQDVS ASSVLDIQGC  480
DIQKANFQVQ EGLWEIIYPS DVPPQSGLSH CGPSGGNSSE SEIKVGDCQK DGLG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.24e-52NAC family protein