PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN06572.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 583aa    MW: 66212.9 Da    PI: 5.2928
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN06572.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.3e-5661331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdeelv +yLk+k++g+k++l e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s + 
  PIN06572.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIDL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVSS-QM 102
                 79****************************.99***************6434555777*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 ++vg+kktLv+y+grap+g +tdWvmheyrl
  PIN06572.1 103 RAVGMKKTLVYYRGRAPHGIRTDWVMHEYRL 133
                 99***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIDLEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVSS QMRAVGMKKT LVYYRGRAPH  120
GIRTDWVMHE YRLDERECEV LTGLQDAYAL CRIFKKSLNP PKVGDRYVTT SASDRSPSVD  180
LYSEGKYDDL DCSDYPLPLN SSTPINIAGS SSSSDARWTQ YLSEEAFSFS NPYSNCAPRP  240
YPPSKVDIAL ECARLQHRFS LPPLEVQGYP QTAFSNNPMM SNSNVFHANI GQPAPDIVQE  300
ILSVAQASQD LQNQEIYASP VDDFSFFLNQ EHDHDMSSSR YLDNLKEENN NNGSIEIVDN  360
IDEAFQTGRM VENLRWIGMS NKELEKAFSD EFKAVPLENI SNIQSEYHDF EGETSNHNFN  420
TFTNTDANDN ISIGHMNNND SDKFLDDGDI DDFSSTPNFE VYEKIEINHG LLVSTRQAPK  480
TYYHKVAPSK TVQVHINPTV IHQYPVAKSG SITSRSLSEK LVSFSRNMLK TITKSQSWEG  540
DDRENVSPKV VQGVNDNIRP YLTFALALCA IWVQIVTPSS WLL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-153NAC family protein