PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN06388.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 397aa    MW: 44637.2 Da    PI: 5.1531
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN06388.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.3e-52261531128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 l+pGfrFhPtdeelv +yL++kv gk++++ ++++e+d+yk+ePw+L   +++k+++ ewyfFs+ dkky +g+r nrat +gyWkatgkd+ v + k+
  PIN06388.1  26 LAPGFRFHPTDEELVRYYLRRKVCGKPFRF-QAVTEIDVYKSEPWELAdySSLKTRDLEWYFFSPVDKKYGNGSRLNRATGKGYWKATGKDRCVRH-KN 122
                 579*************************99.88**************84347777888*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g+kktLvf++grap+g++t+Wvmheyrl
  PIN06388.1 123 QTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 153
                 99***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    
MEMGQEVVVS AVGTPAAMGN PPPTSLAPGF RFHPTDEELV RYYLRRKVCG KPFRFQAVTE  60
IDVYKSEPWE LADYSSLKTR DLEWYFFSPV DKKYGNGSRL NRATGKGYWK ATGKDRCVRH  120
KNQTIGMKKT LVFHSGRAPD GKRTNWVMHE YRLCDSELEK ARVSQDAFVL CRIFQKSGLG  180
PPNGDRYAPF VEEEWDDYAA LVVPGGDTED DVANGEEARV ECTDLDQDTQ PLSIAPPIVE  240
DPIESPNLPL ACKRERSGEP EPESLSLAQS KRSKHDDPNS NHANGSEDST TTSHNPPTMM  300
MTKNISSSLL EFPLLESIGS KENLSSNTPM FDSSNLEKSV PPGYLKFISN LENEILNVSI  360
EKETLKIEVM RAQAMINILQ SRIDVLTKEN EEIRRRA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.11e-111NAC family protein