PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN05939.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 177aa    MW: 20733.6 Da    PI: 9.7028
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN05939.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM132.82.4e-41151392128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                   G+rF Ptd e++ +yL kk+++++l++   +++v++y+++P++L +++ ++   wyfF++r++ky++g+r+nra+ +gyWka+gk++++l+ +++++
  PIN05939.1  15 SLGYRFAPTDLEVIRDYLMKKIKNEPLPA-PLVHDVNLYQYNPETLVESYPEHIYGWYFFTPRERKYKNGSRPNRAAGTGYWKASGKEEPILA-GRSVI 111
                 57*************************99.78**************867666777**************************************.999** PP

         NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                 g k+tL+fy+g++p+g +t+W+m+e+++
  PIN05939.1 112 GHKRTLAFYQGNHPNGDRTEWMMQEFTI 139
                 **************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    
MAEDNPAAAF LADLSLGYRF APTDLEVIRD YLMKKIKNEP LPAPLVHDVN LYQYNPETLV  60
ESYPEHIYGW YFFTPRERKY KNGSRPNRAA GTGYWKASGK EEPILAGRSV IGHKRTLAFY  120
QGNHPNGDRT EWMMQEFTIA GPQPLRRDEN DMRLDDWVLC RIYKSHIKAR ENKKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-51NAC family protein