PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN05938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 579aa    MW: 64667.2 Da    PI: 4.4812
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN05938.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.63.8e-43161442128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                 ppG+rF Ptd el+ +yL kkv++++l++ + i +v++y+++P++L  +  k ++k+wyfF++r+kky++g+r+ ra+ +g+Wkatg dk++l +  + 
  PIN05938.1  16 PPGVRFAPTDLELIYYYLMKKVNNQPLPF-DEIYDVNLYQYNPETLAeNYPKLGDKDWYFFTPREKKYKNGSRPDRAAGNGFWKATGADKPILLRnhTI 113
                 9****************************.77**************845666799**************************************984344 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g k+ Lvfy+g++pkg+ktdW+m e+++
  PIN05938.1 114 TTIGWKRALVFYQGKHPKGNKTDWMMYEFKV 144
                 45***************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    
MAAELNPATL LSRRCPPGVR FAPTDLELIY YYLMKKVNNQ PLPFDEIYDV NLYQYNPETL  60
AENYPKLGDK DWYFFTPREK KYKNGSRPDR AAGNGFWKAT GADKPILLRN HTITTIGWKR  120
ALVFYQGKHP KGNKTDWMMY EFKVDQPSRN KRGGDGMRLD DWVLCRIYKK VNRTRENNQQ  180
AAEASPLEDS TPVDQNNTPE FTEADDPEVD NNENLAQIED TVATLYTTEV GNNNNNHLGP  240
IVIHDDYATQ VAANGYDING VPLVTSISEQ ADWIVQDLAN FSIDPPSQNA LPQNVPVASS  300
HHMNFGFDGV TNPFPQPQNV PEPLFFDGEG WGIQKGYFQV QEGFLETQYA TNPPQTGHSL  360
FGPSTSNLSE SKIGIQGFDK DGVTNSFAQP QNVSEPSSFD MAGCGFQEGD FQVREGFDKD  420
GVTNSFAQPQ NVSEPSSFDI AGCGFQEGDF QAREGFNWKT PYPTDPPQMR SSHLGPSTSN  480
LSKPKIELED YDKDGVTNPF AQTQDVSASS VLDIEGCDIQ KGNFQIREGL WEILYPSDVP  540
PQSGLSHFGP SSVNLSESEI KVEDCEKHGH GMKRIHHDS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-51NAC family protein