PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN05488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 262aa    MW: 30332.2 Da    PI: 5.241
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN05488.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.87.6e-4861353128
         NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 +GfrFhPt+eelv++yL++k++g++ ++++vi+ vdiy+++Pw+Lp+    ++++++++w+fF++r++++a+g r+nr tk+gyWkatg+  ev+s+++
  PIN05488.1   6 VGFRFHPTEEELVSYYLREKLKGTTPDIDRVIPVVDIYNYNPWELPQlageRCHGDTEQWFFFIPRQEREARGGRPNRLTKEGYWKATGSPGEVYSSQN 104
                 7***************************99***************9656766666888***************************************** PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + +g kkt+vfy+grap+g+kt+W m+ey++
  PIN05488.1 105 QRIGRKKTMVFYEGRAPHGRKTSWKMNEYKV 135
                 *****************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    
MNNLGVGFRF HPTEEELVSY YLREKLKGTT PDIDRVIPVV DIYNYNPWEL PQLAGERCHG  60
DTEQWFFFIP RQEREARGGR PNRLTKEGYW KATGSPGEVY SSQNQRIGRK KTMVFYEGRA  120
PHGRKTSWKM NEYKVFDNYD HEHAGADPQV REELSLCRIY KRSKCSRAFD RRPPTEVAAG  180
NEEAVHHHRN HADEAINPPE IINGGVDSPS SGDQNTNPSP SSGDQNTNPS QSVESENNWD  240
MATDNEPMWD WEEFYSFTMW DI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.21e-78NAC family protein