PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN04138.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 197aa    MW: 22610.2 Da    PI: 5.6194
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN04138.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM69.21.1e-21121571128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev..ikevdiykvePwdLpk........kvkaeekewyfFskrdkkya.......tgkrknratk..s 80 
                 lp G+rF Ptd el ++yL+kkv+++++  +++  i+  + y++ P+ +          ++++e +e+   + +d+ +        ++++k r++    
  PIN04138.1  12 LPIGYRFAPTDLELATFYLQKKVSSRPVVGDDIkeIDAHEFYSHSPEAIGIyrsqdhdlTTEQEGEEVPM-IGKDRIEMneefhkqEENQKIRIVGdgI 109
                 699************************6664322366667999999999633566666523333334322.2222222211221113345555444447 PP

         NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 gyW+++gk++ ++++ g++   k  +v+++g+ ++g++t+W ++ey+l
  PIN04138.1 110 GYWRSSGKKEVIYDAMGRAYAFKIHFVYFSGSPNRGKQTHWRLEEYHL 157
                 99********************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    
MSFGDGICPI ELPIGYRFAP TDLELATFYL QKKVSSRPVV GDDIKEIDAH EFYSHSPEAI  60
GIYRSQDHDL TTEQEGEEVP MIGKDRIEMN EEFHKQEENQ KIRIVGDGIG YWRSSGKKEV  120
IYDAMGRAYA FKIHFVYFSG SPNRGKQTHW RLEEYHLITS DRSCDDGGRG GGETRNSKID  180
DWVLGRITRG RNYASFF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.12e-15NAC family protein