PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN03909.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 267aa    MW: 30575.8 Da    PI: 6.6047
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN03909.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.34.1e-4261343127
         NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 +GfrF Pt+eelv+++L++k++g++ e+++vi+ +diy+++P++Lp+     + a+ ++w+fF++r++++a+g r+nr t++gyWkatg+  +v+s+++
  PIN03909.1   6 VGFRFYPTEEELVSFFLQNKLNGTRPEIDRVIPVLDIYDYNPSELPHlageYCPADGEQWFFFIPRQEREARGGRPNRLTTEGYWKATGSPGDVYSSQN 104
                 7***************************999***************645654555889***************************************** PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyr 127
                 +++g k+t+vfy grap+g+kt W m+ey+
  PIN03909.1 105 RVIGRKRTMVFYVGRAPNGRKTLWKMNEYK 134
                 *****************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    
MKRESVGFRF YPTEEELVSF FLQNKLNGTR PEIDRVIPVL DIYDYNPSEL PHLAGEYCPA  60
DGEQWFFFIP RQEREARGGR PNRLTTEGYW KATGSPGDVY SSQNRVIGRK RTMVFYVGRA  120
PNGRKTLWKM NEYKAIASQD HEPSSSSSSS TFAASQLREE FSLCRIYKRS KCLRAFDRRP  180
PSEAVRGVEA AVAGPHHHRH HEAAAFNNQL HNPVAPDITD NWSDSSSSLG DYMQTNNYQS  240
PSMDSGNNPD LAADHEPLWD WDQFNFF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.23e-74NAC family protein