PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN03908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 270aa    MW: 31220.4 Da    PI: 5.8655
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN03908.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.34.8e-4391392128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 p+GfrF Pt+eelv+++L++k++g++ ++++vi+ +diy+++P++Lp      + a+ ++w+fF++r++++a+g r+nr t++gyWkatg+  +v+s++
  PIN03908.1   9 PVGFRFYPTEEELVSFFLQNKLNGTRPDIDRVIPVLDIYDYNPSELPYlageYCPADGEQWFFFIPRQEREARGGRPNRLTTEGYWKATGSPGDVYSSQ 107
                 89***************************999***************545654555889**************************************** PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++++g k+t+vfy grap+g+kt W m+ey++
  PIN03908.1 108 NRVIGRKRTMVFYVGRAPNGRKTMWKMNEYKA 139
                 ******************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    
MEDDREYFPV GFRFYPTEEE LVSFFLQNKL NGTRPDIDRV IPVLDIYDYN PSELPYLAGE  60
YCPADGEQWF FFIPRQEREA RGGRPNRLTT EGYWKATGSP GDVYSSQNRV IGRKRTMVFY  120
VGRAPNGRKT MWKMNEYKAT ASHDHEPPPS SSSTFATPQL MEEFSLCRIY KRSKCLRAFD  180
RRPPSEAVRG VQEAVAGPHH HRHHEAAAFN NQLHNPPAPD ITDNCSDSSS SSGDYMQTNN  240
YQSQYVDSGN NPYLATDREP LWDWDQFNFF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.14e-74NAC family protein