PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN03750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 594aa    MW: 67025 Da    PI: 4.6703
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN03750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.77.7e-52491761128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 l+pGfrFhPtdeelv +yL++kv +k++++ ++i+e+diykvePwdLp  +k+k+++ ewyfFs  dkky +g r+nrat++gyWk+tgkd+ v++ k+
  PIN03750.1  49 LAPGFRFHPTDEELVRYYLRRKVCRKSFHF-DAISEIDIYKVEPWDLPslSKLKTRDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRGVYH-KT 145
                 579**************************9.99***************5448888888**************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + vg+kkt+v++ grapk ++t+Wvmheyrl
  PIN03750.1 146 QIVGMKKTFVYHIGRAPKRQRTNWVMHEYRL 176
                 9****************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    
MSNPSQFTIQ PLTHLPKKPI VFKFHKIPHL ILWFVMESAK GKKRSSGLLA PGFRFHPTDE  60
ELVRYYLRRK VCRKSFHFDA ISEIDIYKVE PWDLPSLSKL KTRDLEWYFF SVLDKKYGNG  120
ARTNRATEKG YWKTTGKDRG VYHKTQIVGM KKTFVYHIGR APKRQRTNWV MHEYRLTDLE  180
LERAGIFQDA FVLCRVFQKS GSGPKNGEQY GAPFVEEEWE EDELELVPKA EAAEEFDFGD  240
DAYLDGHDLE QILGSDAPSD TSSLPVNFHT ADGSFGEEIV ETVPDTQNLL LNADQQYCEP  300
QQHEDKNLYD LPAPCDTDVR TVKHEYICES SKSGNSDVLD YLLDEPFLDT STELPYGNGG  360
FIEANDLSNP IETNSSPFDV LEYLTFFDAN DDNTQHFACD PSVMLGNEEL KPDQALLPPE  420
ELNDETKQST LPSGPLVDNN NNDDASPSDK LDSAKDESDY PYPFVKQASH MLGSIPAPPA  480
FAAEFSSKDA VLRLNSLSQP SSSVHVTAGM IQIRNLTMNQ NGREESLGKL GILNIVLSFG  540
FSRGDDGSDS LESSVRILPG KNLSSFSRGW FYFICFWVLI LSMSYKMGTC ICAK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-134NAC family protein