PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN03657.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 360aa    MW: 41031 Da    PI: 7.4116
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN03657.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.41.8e-50241492128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ ++s++ + +
  PIN03657.1  24 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFIDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIKSENLRSI 121
                 79***************************.89***************8778899********************************************* PP

         NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                 glkktLvfy+g+apkg +t+W+m+eyrl
  PIN03657.1 122 GLKKTLVFYSGKAPKGIRTSWIMNEYRL 149
                 **************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    
MAIAAAMNNQ QNNKQDEHEQ DIVMPGFRFH PTEEELVEFY LRRKVEGKRF NVELITFIDL  60
YRYDPWELPA LAAIGEKEWY FYVPRDRKYR NGDRPNRVTT SGYWKATGAD RMIKSENLRS  120
IGLKKTLVFY SGKAPKGIRT SWIMNEYRLP HHETERLQKA EISLCRVYKR AGVDDHASLP  180
RSLPTKSKSK NHTIDIFQAT YGGSSQQNDA KIVESSPSSS ADIGTNLALS QQNSYAISPI  240
VPMDQTPSIS PDDDHRIMMM QQSKNSCSNM IFSSSSSHAI DDLHKLVNNY SINHENHDQY  300
NINPNILVPH FSNLQPPAPQ QQAVLALPGS LQAAFSDRLW DWSGVSEAGK DYTNLFNCKE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-111NAC family protein