PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIM99548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 369aa    MW: 42488.8 Da    PI: 6.7733
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIM99548.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.24.2e-161462150
         NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                lppGfr+hPtdeelv +yL++k+ +k++++ +vi e+d+yk++P++Lp++
  PIM99548.1 14 LPPGFRYHPTDEELVFYYLTRKIYSKRHRI-DVIGETDVYKWDPEELPER 62
                79*************************999.99**************963 PP

Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    
MKVDADSFGN EDILPPGFRY HPTDEELVFY YLTRKIYSKR HRIDVIGETD VYKWDPEELP  60
ERLDPYTSGI QSTLCDHSFR CSCVSKWTYL SCPVRRLCQQ PDEKPACAVC GSFKNIWVCL  120
ICGFVGCGRY EKGHASGHWS DTQHHFSLEL QKQRIWDYVG DKYVHRLNQS RAEGKSVIAN  180
SRCSSAEECE TCGYEEEEGL DGALFSSKIE GTLDEYNRLL ASQLDIHRQH YELLLAEARS  240
GKESSTAKAV EKAIFSKTHE LEYKLEKCAD EKKAVADRNQ ELMKKQEFLQ NKFKEIEERE  300
RSLLKSKDEQ ISDLQEQIRD LKVYVEVQRM VTNMGDSNGI KGGTILPVEK NQLSSGNSKR  360
RSKSGRHRN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-16NAC family protein