PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIM98875.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 608aa    MW: 67407.8 Da    PI: 4.5835
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIM98875.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.44.8e-5291371128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lp+G+rF+Ptdeelv++yL+ k++g++ e+ ++i+e+d++++ePwdLp  + ++++++ew+fF+++d+ky++g+r nrat++gyWkatg+d++++s+kg
  PIM98875.1   9 LPVGYRFRPTDEELVDHYLRLKINGRHKEV-TCIREIDVCRWEPWDLPdlSVIESTDNEWFFFCPKDRKYQNGQRLNRATEKGYWKATGRDRNITSRKG 106
                 799************************999.89**************96448888999***************************************** PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g+kktLvfy+grap+g++++Wv+heyr+
  PIM98875.1 107 AKIGMKKTLVFYTGRAPDGKRSNWVIHEYRA 137
                 *****************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    
MAVLPVKALP VGYRFRPTDE ELVDHYLRLK INGRHKEVTC IREIDVCRWE PWDLPDLSVI  60
ESTDNEWFFF CPKDRKYQNG QRLNRATEKG YWKATGRDRN ITSRKGAKIG MKKTLVFYTG  120
RAPDGKRSNW VIHEYRATDK SLDGTHPGQG AFVLCRLFKK AALKPDENSE SSNLNEVEEI  180
VLSPTVAKSS AEDEQSESVT PAFDGQAEMQ PPTAESRPTL SSEEAMVDNP VPIAWPSNSC  240
IVDEMEENVL DTTSIPPNPE LEKLLEDFCP SLEQLDWKMF SPLHSQVQSE LGTYSNFSGD  300
INNGQPNVPS QYGTNVININ EFLNEVLVEP EEQSYGAIYS HSSLDSPKYV LQMAKDGNSS  360
CESEGEVSQQ QVQVMFQSGP IEEAIMQESP FQSEVTSQMA ALERSSHSSN YDNATLGFQN  420
NSYSLPNDFS SLSAGNQIPY LANTEEARGY SSAVGDTTGT GIKIRTRQVQ KQPSVQNSTA  480
QGIAPRRIRL QKKFQVGPVE CGISNESADS KTIHEDESTQ DDKATKVPTP AESKESTSGE  540
ASKDVESHDS STSLKSKNDL PGNEPEDVSS LSTGRAPVPV SSSRYMPKVL LAISFIIMLV  600
AVWGYYVF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.21e-87NAC family protein