PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIM98723.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 314aa    MW: 34990.4 Da    PI: 7.7854
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIM98723.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1752.1e-54141421129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeel+++yL kkv +  ++  ++i+e+d++k+ePw+Lp k+k +e+ewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+ + +
  PIM98723.1  14 LPPGFRFHPTDEELITYYLFKKVLDCGFTS-RAIAEADLNKCEPWHLPGKAKMGENEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSkSCS 111
                 79*************************999.89***************99999****************************************984556 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                 lvg+kktLvfy+grapkgek++Wvmheyrle
  PIM98723.1 112 LVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 142
                 7****************************85 PP

Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    
MEKNYQYERN ESHLPPGFRF HPTDEELITY YLFKKVLDCG FTSRAIAEAD LNKCEPWHLP  60
GKAKMGENEW YFFSLRDRKY PTGLRTNRAT EAGYWKATGK DREIYSSKSC SLVGMKKTLV  120
FYRGRAPKGE KSNWVMHEYR LEGKLAYHYL SRNSEEEWVI SRVFQKPGSS TSAAAGGGAR  180
KRPPSGGTTI TNISDVSSPS SVSLSPLVEL SSAGAAKEHV PCFSTTAAAS FNLNSLFDLP  240
PPPRPSSMAA LILDPISPLS SAFPENYFRP SVISAVHGGT DDEMFSYAGS LMSQWPAPEN  300
EKLCTNELDC MWSC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.13e-99NAC family protein