PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIM98513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 297aa    MW: 33850.8 Da    PI: 9.1311
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIM98513.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.5e-5491341128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeel+++yL+++++++++++  +i+evdiyk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra+ sgyWkatg+dk+++s +++ 
  PIM98513.1   9 LPPGFRFHPTDEELIMHYLRNQATSRPCPV-AIIPEVDIYKFDPWELPEKAEVGENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-GSKY 105
                 79****************************.88***************99999*****************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfykgr pkg ktdW+mheyrl
  PIM98513.1 106 VGVKKALVFYKGRPPKGLKTDWIMHEYRL 134
                 ***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    
MVGRNSPGLP PGFRFHPTDE ELIMHYLRNQ ATSRPCPVAI IPEVDIYKFD PWELPEKAEV  60
GENEWYFFTP RDRKYPNGVR PNRAAVSGYW KATGTDKAIY SGSKYVGVKK ALVFYKGRPP  120
KGLKTDWIMH EYRLSETRSQ PYKQSGSMRL DDWVLCRIYK KKNLGRTYTH HDQQRVVEDS  180
FAQIVTNDHA TSDQPQPHKF PRPSSLTHLW DFDNIASISQ LLLNDTSSYN IFSFNYINQE  240
TTTTTTTNSG SFSASGSGSG GDVAGRHQLG HVQQPCTDSR KSQVNQTIFV NPAYEMQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-103NAC family protein