PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIM97404.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 333aa    MW: 37765.9 Da    PI: 6.1459
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIM97404.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-51151431128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s +
  PIM97404.1  15 VPPGFRFHPTEEELLQYYLRKKVAYEKIDL-DVIRDVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIYS-N 111
                 69****************************.9***************964444222455**************************************.8 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  + +g++ktLvfy grap+g+k+dW+mheyrl
  PIM97404.1 112 CKRIGMRKTLVFYGGRAPHGQKSDWIMHEYRL 143
                 889***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    
MSENMNLSVN GHSQVPPGFR FHPTEEELLQ YYLRKKVAYE KIDLDVIRDV DLNKLEPWDI  60
QEKCKIGSTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NCKRIGMRKT  120
LVFYGGRAPH GQKSDWIMHE YRLDDNSNHA PNIGTVDSGP EEGWVVCRVF KKKNYHKTSS  180
DHHPATSSRN NDNILDQILM CIGRSSSTST FKQEDHEEFP NTAPDFAHLP DLEIPAVKSP  240
TNDIITEMAP SNSEPCDWVA LDRLVASQLN GSETVNHEDF SFSFDHDDQV QLMNMANGPG  300
RPNTDMDFWS FARTSSSLSL SSSSSDPLSH LSV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-105NAC family protein