PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028557281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family GRF
Protein Properties Length: 463aa    MW: 51547.9 Da    PI: 9.6244
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028557281.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.51.2e-23188232145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCs+++ +++k+CErH+hr+r+rsrk++e+
  XP_028557281.1 188 DPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRSRNRSRKHVES 232
                     79****************************************996 PP

2QLQ62.89e-22121157137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FTaaQ+ +L++Q+l++KyL+a++PvPp+Ll +iq+
  XP_028557281.1 121 QPFTAAQWRELEHQALIFKYLVAGVPVPPDLLIPIQR 157
                     69*********************************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    
MTRGKQKIEA QKRNAEKNQK SKGSQLEARA VALKSSCPIC KVQLANGKRE AKLYSRVLAL  60
LSSHIFFFHF SLFFTIFFLP LSSSLLPVGE EMSSMAAAGS GGKGWMQMPS TAVAAEMGWR  120
QPFTAAQWRE LEHQALIFKY LVAGVPVPPD LLIPIQRSLE ALPSRFYHHY PAHSSPVGYF  180
SYYGKKLDPE PGRCRRTDGK KWRCSKDAHP DSKYCERHMH RSRNRSRKHV ESKSNISPQQ  240
SQSNISSSST STSHVALGSS GSFQNISMQS AMTGASKTQG LCSGTSASSH LQSDSQHYGK  300
EYRYLHGAKI DLDKHNFFSE YPGSLQTDLS VNSSPDNSWG LMPSQVPSFS ISKGKTSNPY  360
GHYSSQLHAM QNLNEVTMRS IPKQQEQLHS YFKSNFGLPD PAKQECQGLG TAFNEWPKAR  420
ESWLDLKDEH SERNSFSATQ LSISIPMASS DFSTTTCCSP NDD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-42GRF family protein