PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_028556133.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 25726.2 Da    PI: 6.8773
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_028556133.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.69e-251059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +i+n + rqvtfskRr g++KKAeEL +LCdaev +++fs tgkl+++s+
  XP_028556133.1 10 KIDNATARQVTFSKRRRGLFKKAEELAILCDAEVGLMVFSATGKLFDFST 59
                    69**********************************************96 PP

2K-box614.6e-219217220100
           K-box  20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      ++ L +++ +  +++R++ GedL+ L+l+eLqqLe+ Le++l+++ +kK e +leqi++l+kk  +l een++Lr +++e
  XP_028556133.1  92 SMTILSNQVAEATHQLRNMRGEDLHGLTLQELQQLEKTLETGLSRVTQKKGEQILEQINHLRKKGVQLMEENTRLRYQVAE 172
                     566788889999999*************************************************************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    
MAREKIKIRK IDNATARQVT FSKRRRGLFK KAEELAILCD AEVGLMVFSA TGKLFDFSTS  60
SMKEIIDRYN VHSKDHTAVD VPSLDLQLEN GSMTILSNQV AEATHQLRNM RGEDLHGLTL  120
QELQQLEKTL ETGLSRVTQK KGEQILEQIN HLRKKGVQLM EENTRLRYQV AEMSKMGKQV  180
VVDPENAFHE DGQSSESVTN VTHCGNPYEN DDTSDTCLKL GLSCSGWK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.12e-72MIKC_MADS family protein