PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020702289.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family GRF
Protein Properties Length: 369aa    MW: 40387.7 Da    PI: 7.8882
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020702289.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.23.8e-2576120145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  XP_020702289.1  76 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKHVET 120
                     79****************************************997 PP

2QLQ621.6e-211550237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FTa+Q+++L++Q+l++KyL+a+ PvPpeLl++i++
  XP_020702289.1 15 PFTASQWEELEHQALIFKYLIAGIPVPPELLLPIRR 50
                    9*********************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    
MNSTAAAVGV GCRPPFTASQ WEELEHQALI FKYLIAGIPV PPELLLPIRR GYETMAARFY  60
HHPALGYCSY YGKKLDPEPG RCRRTDGKKW RCSKDAYPDS KYCERHMHRG RNRSRKHVET  120
PQALSQSQSS CSTVTSLAPT SLGSSGSGSG SGATASIGGG SCSGGSFHSL PLHSIPSMHH  180
QVSGIGAATS SHLSIDPSSY GNVISKDFRY VHGSKSGLDE RGFYSEAPGS ARVLGMDSAL  240
DSSWRLLSSP VSTFPLSKER ENSFLHGSYP QLQPLQELGQ VTISSLPKQH QQHQHSFFGT  300
DYGSTEPPIK TEQPLRPFFD EWPGTRDSWS DLEDERTNRN SFSTTQLSMS IPMSSSDFST  360
TSSRSPNDD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-49GRF family protein