PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020700706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family GRF
Protein Properties Length: 592aa    MW: 64691.7 Da    PI: 7.2264
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020700706.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.41.2e-23229272144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e
  XP_020700706.1 229 DPEPGRCRRTDGKKWRCSRDAVVDQKYCERHMNRGRHRSRKRVE 272
                     79****************************************98 PP

2QLQ44.35.5e-16158194137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT +Q+ +L++Q+l+yKy+ a++ +P++Ll+ i++
  XP_020700706.1 158 GPFTTSQWLELEHQALIYKYIDAKMSIPSNLLMTIRR 194
                     59******************************99975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    
MDLGCSLSSD GLVSVYSDPN IRMPSSLFPL ESEPSKQRGL FQSSFSKHGR SIVVEDNDEY  60
WSRLKTARCD TMLTATSKAA ACLLRSGSHT LFPDGEQMLN FSSWKPEALV LNNHWNLPFF  120
NHPSSSSCSS AYPTFRNAGV CSDNSTLNMH GAVSGIRGPF TTSQWLELEH QALIYKYIDA  180
KMSIPSNLLM TIRRSNNQSG FSSFTAGSFR QTGTLGWGNF HPGFSGGADP EPGRCRRTDG  240
KKWRCSRDAV VDQKYCERHM NRGRHRSRKR VEGHLGHAAK AAVPAITSSQ SASAVSSGGS  300
SNNLTTAQQQ SENLQSSGTE PSSLQLDRLL INKDNTGDQR RNSQGLSMMT DLISKSTGTL  360
LPISKQQNPF EETSTRVDLG LISTDSLPNS QGNCSSENLS FVFYNPEMND QHIRSHPFRH  420
FIDDWSKNPS DADVADKMQS YRTELSISIP ISSLGFSSSP CSPIQDKLSF PPFRLSSELD  480
PLNAGSQRGL SWVPISWEPT IGGPLGEVLT NTSTTPKDLG SNLSTSSLNF MTDGWNMRTR  540
FESSPTGVLQ DSGFGSMSSS TGSSPRAENH KAHESDDLLG TTFVNLSVNP SL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-59GRF family protein