PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020697747.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family GRF
Protein Properties Length: 264aa    MW: 30509.1 Da    PI: 8.8142
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020697747.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.33.5e-2582125144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  XP_020697747.1  82 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 125
                     79***************************************997 PP

2QLQ61.72.1e-211146237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FTa+Q+q+L++Q+l++Ky+a++ P+P++L+++i++
  XP_020697747.1 11 PFTASQWQELEHQALIFKYMASGIPIPHDLIVPIRR 46
                    9*********************************86 PP

Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    
MMSGRSSSRY PFTASQWQEL EHQALIFKYM ASGIPIPHDL IVPIRRSFLL DSTSTSPSLA  60
FPPHTQLGWS CFQMGYGRKT EDPEPGRCRR TDGKKWRCSK EAYPDSKYCE RHMHRGKNRS  120
RKPVEISLAT KTNHSSSTSS AQMSPYSANL SISTPEICHH LCPYPSSSVT SPFQLDSANY  180
SDREYRQGAE IRRSSSEFKP QWMSSMAKAK QSNYTLSKEE EEERQRPLRH FFDECPERNK  240
EQWMDMEDES SSYTKTQLSI SFPK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-55GRF family protein