PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020692950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family GRF
Protein Properties Length: 559aa    MW: 60393.7 Da    PI: 9.1002
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020692950.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.6e-24203246144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e
  XP_020692950.1 203 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVE 246
                     79***************************************998 PP

2QLQ40.58.6e-15133166134
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                     +aFT +Q ++Lk+Q l+y y+ an+P+P +Ll  
  XP_020692950.1 133 GAFTLSQRMELKQQMLIYNYIWANVPIPTNLLSS 166
                     59*****************************976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    
MDSHGFLGMK VLVGSSPCSL SPPLASSDLE SIRKRGLFTS HFLKQGRSCR ADEDEQRSPK  60
IARSMALSSA SNGEQMLSFS SSKPSSLVYS CDKTSVLATL PPSSAPSSLV RRAGLNSVDL  120
NVKMQGAVRG PSGAFTLSQR MELKQQMLIY NYIWANVPIP TNLLSSLMRG LSPAWFSVCS  180
TGSVRPNAAW WGYFHPGYVG NADPEPGRCR RTDGKKWRCS RDAVPDQKYC ERHINRGRHR  240
SRKPVEGHGE HTKITMPGVT NPTLVSSVPS GGQSSNSLSV TRHQIQIPHA TVNASSSQFW  300
MPTSANATNN RKESPQDHSI LTSTTKPCDS LFTTSRNYNP LSETSSIGLN AGNILKSHLS  360
GSFLANNNFD TPLELHDQQN QQPQVLGHFI DDWPASRSES SNIIWPGVEE IQSEKTQLSM  420
PFPLASSDFS SSNSSPAPER LSPLRMGLGL IGVPNEQNSA MKWRATASMG GPLGEALTST  480
SSTLLDGKKN FLSLINDGWD LNPQLASSTN NVIQSTTVSS VSSGSDNGVK VEKNANEGLS  540
CLFGPNNVNS LNLPPFVSI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-49GRF family protein