PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020692853.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family HB-PHD
Protein Properties Length: 827aa    MW: 92486.8 Da    PI: 6.879
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020692853.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox375.8e-125876301356
                     HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + L e+ +kn+yp+++e+e LA++l++t +qV+ WF N R   +
  XP_020692853.1 587 KKLSEYLKKNQYPTKKEKESLAQELSMTYKQVTKWFDNARHSSR 630
                     568888899*******************************8765 PP

2Homeobox36.49e-12675724756
                     --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     f+++  + L e+F++++yps+e++eeLA++lg+t r+V+ WF   R + +
  XP_020692853.1 675 FKATYKKKLDEAFQESQYPSREKKEELAQELGMTFRKVSRWFETARRRSR 724
                     67777899***********************************9999987 PP

3PHD41.23.7e-14236291151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C  Cg+    ++++++lCdg C++ fH+kCl+++l se++p g   wlC++C++k
  XP_020692853.1 236 FCGKCGSkeVSADNDIILCDGvCERGFHQKCLNPPLLSEDIPTGdeGWLCPQCDCK 291
                     699999976667********77********************9999*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    
MASPEKQDDK KKISTRAKKH SKTQKQDSKP GSSRIKLSKS GISSSQKVGP KKQTAQNKLI  60
PQYEKANMVN GAAKVSNKSV SKRKKSLPKL KGSYSLRSLD RGRVLRSKLS TAKCKTTMNP  120
GSNSENLVTR KKKVGKKKIK KSGQDELSRV KKHIRYMLNR MNYEQSLIDA YSGEGWKGQS  180
AEKLRPEKEL ERAKSEILRC KLKIREIFKH LESLLAEGRL QESLFDPDGI DSEDIFCGKC  240
GSKEVSADND IILCDGVCER GFHQKCLNPP LLSEDIPTGD EGWLCPQCDC KVECIDLLSE  300
FRGTDLSIED SWERIFPEAA VLANGNGQYD DLNLPSDDSE DDDYKPEAQV VEVDDQEEES  360
GESDSSSSSY DSTSSDDNRN QATVELPSDD SEDDDYDPDA VDPDKEIQKS KSSSDESDFT  420
SDSDEFCAEL KKISYAEEAS SCSQPNLEFF VDSGRDEMKD KDKIYDYYEV PSAMLDIDKQ  480
ESGLSLSNKR GRERLDYKKL YDEAYGKSSS DSSDDEDWTE MSSPKKLKKT DDQGIEVAND  540
VFVKVTPKLP KKIASSSAVE KDHGPQEPGS SGCSSATVLR NSEVASKKLS EYLKKNQYPT  600
KKEKESLAQE LSMTYKQVTK WFDNARHSSR VSSKQLSKIC TATSKEVSVH CDTPASHSEP  660
DKGAAAKSPL SSKLFKATYK KKLDEAFQES QYPSREKKEE LAQELGMTFR KVSRWFETAR  720
RRSRSKESSN PCRIPGSHKF DIDEEEKTTG ASTPDTPANA KPDNRVSPLD KVSTPTSSTS  780
PWRHDHEIDL DSPIANGAAS NAKEKKAAVD DRQKAIAKEL RRMRRGR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1812825RQKAIAKELRRMRR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-86HB-PHD family protein