PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020692571.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 26503.1 Da    PI: 10.0576
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020692571.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.52.3e-301059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rienk++rqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gklyeys+
  XP_020692571.1 10 RIENKIKRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSNKGKLYEYST 59
                    8***********************************************96 PP

2K-box71.92e-24881581482
           K-box  14 aeslqqelakLkkeienLq..reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82 
                     ++ +   ++kLk ++e+Lq  ++ R+l+Ge+L++L+ keLq+LeqqLe+slk+iRs+K+++l+eq +++ +
  XP_020692571.1  88 QADWGLAYSKLKTRVESLQrsQSFRNLMGEELDTLNNKELQHLEQQLESSLKNIRSRKEKMLKEQKKNMEE 158
                     56788899***********66667*****************************************999865 PP

Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    
MGRGRVQLRR IENKIKRQVT FSKRRSGLLK KAHEISVLCD ADVALIVFSN KGKLYEYSTD  60
SSMDKILERY ESYTYAERAI FSSEADPQAD WGLAYSKLKT RVESLQRSQS FRNLMGEELD  120
TLNNKELQHL EQQLESSLKN IRSRKEKMLK EQKKNMEEII AKAKAKALAQ NAAWEQQNRA  180
PYNSSPHHVM ISDSIATPTS RNCQTRYNAE EATQGELRLG KGLLPSWMLS G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.13e-57MIKC_MADS family protein