PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020692569.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 28090.9 Da    PI: 9.9522
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020692569.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.42.5e-301059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rienk++rqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gklyeys+
  XP_020692569.1 10 RIENKIKRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSNKGKLYEYST 59
                    8***********************************************96 PP

2K-box86.84.3e-29881741498
           K-box  14 aeslqqelakLkkeienLq..reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     ++ +   ++kLk ++e+Lq  ++ R+l+Ge+L++L+ keLq+LeqqLe+slk+iRs+K++l+l++i+elq+kek+l+e++k++++ +
  XP_020692569.1  88 QADWGLAYSKLKTRVESLQrsQSFRNLMGEELDTLNNKELQHLEQQLESSLKNIRSRKTDLMLNSISELQNKEKMLKEQKKNMEEII 174
                     56788899***********66667********************************************************9988765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    
MGRGRVQLRR IENKIKRQVT FSKRRSGLLK KAHEISVLCD ADVALIVFSN KGKLYEYSTD  60
SSMDKILERY ESYTYAERAI FSSEADPQAD WGLAYSKLKT RVESLQRSQS FRNLMGEELD  120
TLNNKELQHL EQQLESSLKN IRSRKTDLML NSISELQNKE KMLKEQKKNM EEIIAKAKAK  180
ALAQNAAWEQ QNRAPYNSSP HHVMISDSIA TPTSRNCQTR YNAEEATQGE LRLGKGLLPS  240
WMLSG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-64MIKC_MADS family protein