PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020679600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24838.7 Da    PI: 9.709
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020679600.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.83.8e-301262151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtfskRrngi+KKA+E+SvLCda+v+++ifss gk++ey+s
  XP_020679600.1 12 KRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCS 62
                    79***********************************************96 PP

2K-box81.81.6e-2774170197
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                     yq++sgk+l++ak+e+l+ e++++kke++n+q e+Rhl+GedL+sL+ keL  +e++L+++l+ +R+k++++l++  ++ ++ e+e+++ +  L+
  XP_020679600.1  74 YQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKELIPIEEALQNGLTGVRDKQMDFLKMLKKNERMLEEENKRLTYLLH 168
                     899**********************************************************************9988888888888888777777 PP

           K-box  96 kk 97 
                     ++
  XP_020679600.1 169 HQ 170
                     65 PP

Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    
MVEMGRGKIE IKRIENSTNR QVTFSKRRNG IMKKAKEISV LCDAQVSLVI FSSLGKMFEY  60
CSPSTTLSKM LEKYQQNSGK KLWDAKHENL SAEIDRIKKE NDNMQIELRH LKGEDLNSLN  120
PKELIPIEEA LQNGLTGVRD KQMDFLKMLK KNERMLEEEN KRLTYLLHHQ QLAMEGSMRE  180
LDIGYHQKDR EYAAQMPLTF RVQPIQPNLQ GNK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.16e-87MIKC_MADS family protein