PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020678484.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28745.9 Da    PI: 7.2908
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020678484.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.89.4e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRr g+lKKA+E+SvLCdae a+iifss+gklyeys+
  XP_020678484.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAELALIIFSSRGKLYEYST 59
                    79***********************************************96 PP

2K-box77.82.8e-26841731099
           K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     +++ +  l+q++  Lk +++ Lqr+  hl+Ge+L++Ls+keLqqLe+qLe++lk+iRs+ n+ ll +i+ lq+kek+l e++  L+kk+ 
  XP_020678484.1  84 DSEPQDDLCQDYGYLKGKVDALQRSRSHLMGEKLDNLSIKELQQLEHQLETALKHIRSQTNQQLLHSIDVLQRKEKSLLEQKIVLEKKVI 173
                     45557789*****************************************************************************99985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AELALIIFSS RGKLYEYSTD  60
NCIERIIERY ERYSYAEKAH LMNDSEPQDD LCQDYGYLKG KVDALQRSRS HLMGEKLDNL  120
SIKELQQLEH QLETALKHIR SQTNQQLLHS IDVLQRKEKS LLEQKIVLEK KVIESENSIK  180
MLQQMQASEL SHAEASHSSP PTLEATNSLP TMNIGGHTWP AVLLAKMSHF CSDENCPPAS  240
VEDFCLQINI I
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-73MIKC_MADS family protein