PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020678473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family MIKC_MADS
Protein Properties Length: 244aa    MW: 28170.1 Da    PI: 9.0177
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020678473.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.13.7e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++g+l+e++s
  XP_020678473.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLFEFCS 59
                    79***********************************************96 PP

2K-box94.71.5e-31781735100
           K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     s +++ ++++++ +qe+ kLk+++e Lqr+qR+l+GedL +Ls +eL qLe q+e slk+iRs K++l+l+q+ +l++ke++l e+n+aLr+kl+
  XP_020678473.1  78 SESAVPSKDTQNNYQEYLKLKSKVEYLQRSQRNLMGEDLIELSSRELDQLELQIEMSLKQIRSIKTQLMLDQLCDLKRKEQMLYEANRALRRKLQ 172
                     455588999************************************************************************************98 PP

           K-box 100 e 100
                     e
  XP_020678473.1 173 E 173
                     7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIVFSN RGRLFEFCSS  60
TSMTKTLGRY QKCSYTASES AVPSKDTQNN YQEYLKLKSK VEYLQRSQRN LMGEDLIELS  120
SRELDQLELQ IEMSLKQIRS IKTQLMLDQL CDLKRKEQML YEANRALRRK LQEDGPDIPL  180
ELSWPGGETN GSCERQQPQS DKFFQPLPCS NPSFKIGYSP ICTDEQLNRS SSTHNINGFI  240
SGWM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.12e-94MIKC_MADS family protein