PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020677730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25992.6 Da    PI: 9.2116
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020677730.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.73.2e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+ien +nrqvt+skRr+gi+KKA+E+ vLCdaev++i+fsstgk+ ey+s
  XP_020677730.1  9 KKIENPTNRQVTYSKRRAGIMKKAKEITVLCDAEVSLIMFSSTGKFSEYCS 59
                    68***********************************************96 PP

2K-box89.56.4e-3071169199
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                     yq+ sg +l++a++e++q+ l+ Lk+ +++L+re R+++GedLe L++keL+ Leq+++++lk +R++K++++ +q+++ +kk k+ qe++++L 
  XP_020677730.1  71 YQQLSGINLWSAQYEKMQNTLNHLKEINHKLRREVRQRMGEDLEGLDIKELRGLEQNMDEALKLVRNRKYHVISTQTDTYKKKLKNSQETHRNLM 165
                     8999******************************************************************************************9 PP

           K-box  96 kkle 99 
                     +++e
  XP_020677730.1 166 HEME 169
                     9875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    
MGRGKIEIKK IENPTNRQVT YSKRRAGIMK KAKEITVLCD AEVSLIMFSS TGKFSEYCSP  60
STETKKVFDR YQQLSGINLW SAQYEKMQNT LNHLKEINHK LRREVRQRMG EDLEGLDIKE  120
LRGLEQNMDE ALKLVRNRKY HVISTQTDTY KKKLKNSQET HRNLMHEMEV VEDHTVFGFD  180
DDSSNYEGVL ALANGGSHMY AFRVQPSHPN LHEMGYGPHD LRLA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.12e-72MIKC_MADS family protein