PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cz12g10200.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Chromochloridaceae; Chromochloris
Family GATA
Protein Properties Length: 791aa    MW: 80866.5 Da    PI: 4.9798
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cz12g10200.t1genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.37.6e-17169202134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    C+ C +t+Tp+WR+gp g+ktLCnaCG++y++  
  Cz12g10200.t1 169 CAECAATQTPQWREGPTGPKTLCNACGVRYQRSQ 202
                    ******************************9865 PP

Sequence ? help Back to Top
Protein Sequence    Length: 791 aa     Download sequence    
MHIYLRCSGS DVFEAGGDTD FLGCKSSSAA SFTRQPKTSN GVLGVSNGML PLGLILTHPM  60
GAGARTGPML QSYGMAGLPA LMDQVTAPLH IPQIEDDDDD DALMPGGVSS AALADILQRV  120
QGTGPLQLAS LSNNSDPQVS GSGRSRRMVP QPRPPPAPPS IRGVPGKVCA ECAATQTPQW  180
REGPTGPKTL CNACGVRYQR SQSKAKSNKR LASERRNSPV IRAPAAKQQR IVSGRAGGRM  240
MGSSHGNPSR VVGMGHQAGG FYHEDDGSPP NGSTQILDEE DMEDYNDQGY QIDDDEQPGL  300
LRTKTQEAAD VLSNFRLAAM AGIPPLGTLP ASPGSEGRLL HEQLQVDALP LLHLDDGLRA  360
VDGVPGTPTS TGLPLMDPLQ ANSPSPLVRG RGRGGVRAKE VTTPSPLLGS ITAALDSLGP  420
LQQPPDLPGS LGAPALQLDA PSSSLKTVGV SAGPATAAAA VASAGPSGVG AAGAGQRPNH  480
GAASDESWHT SDSAEEVAFA PGNDATTAAG TSGANGVLGT STGMAASLVL PKTAAMPSSD  540
FQATCSKAVQ FAPELNDYAP VFDSMPRVIN NLPPDRVLDV INLRSQVDVA ANEARAADAA  600
VMAVSQVLHQ KQQQADRAHL SAKSALEQFR EFVVQMIHEY NIDVGNGMLC AAADSNSKGG  660
VVTGDARGAG GSVVSGLLGP DVGALSGVHD AGVKDATAPD DMLVDPEEVK QEEQNQAAEL  720
DTTEQPVANG TIGSKLPVSG KLGPAGLQKL QMKYKQENGA MVNGKAVDMQ PSSSSAPAAC  780
PGAGTTQVAA *
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.15e-14GATA family protein