PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cz10g24060.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Chromochloridaceae; Chromochloris
Family NF-YB
Protein Properties Length: 149aa    MW: 16164 Da    PI: 4.5704
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cz10g24060.t1genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB36.41.2e-1110654095
          NF-YB 40 sefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                    efi +v+se+++ + +e ++ti+++ ++ al +lGf d+v+++kv   +++e  +
  Cz10g24060.t1 10 KEFIQLVSSESNEVATKEVKNTISPEHVIRALEELGFSDFVDEVKVAWDQFKEESK 65
                   69********************************************9999998655 PP

Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    
MEDTEVSLPK EFIQLVSSES NEVATKEVKN TISPEHVIRA LEELGFSDFV DEVKVAWDQF  60
KEESKHTTKL AGRKTKAEEE GLTEAEQIAL QQQLFAAARA RSQSLDAAAA ATVAAAYNQA  120
TGQGAPVALQ PSVNSKPVKQ EVKQEEQH*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08190.22e-17NF-YB family protein