PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cz08g00080.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Chromochloridaceae; Chromochloris
Family GATA
Protein Properties Length: 342aa    MW: 36317.6 Da    PI: 6.0762
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cz08g00080.t1genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.21.7e-16271305135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C +Cg+t++p+WRrgp+ ++ LCnaCG +yr++++
  Cz08g00080.t1 271 CDHCGVTESPQWRRGPQHKPILCNACGTRYRRTNQ 305
                    9***************88888**********9876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    
MAPTPEAVIT LPASMKDAVA FNRSVRSVTD KQRTLGALQH DVSVGHHQLK HSPAGQLRPS  60
YDGSLSSSCF DLDSLDQEPS SKGFISLDDF PYHDTSCLKT TPDATALVMP DLHEAYCDAL  120
LCRKDTGSAN MLLPGNFSPL MDSRQSPDSR LYTLVLLDDV TGDPLRPATD EDADEVARLM  180
SSADTGSSIM SSGAADSWPA FHVAGEDDLE EDSKQVVDNN LTIKQEHTAG AGADECAGGA  240
GVDGPSAFLV PAIPGVPAVP RPFHHKGGGP CDHCGVTESP QWRRGPQHKP ILCNACGTRY  300
RRTNQLGPPI PSSGKPACNK KRAISKTCDS SKVSKQLKMS R*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.12e-12GATA family protein