PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cz07g29070.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Chromochloridaceae; Chromochloris
Family GATA
Protein Properties Length: 600aa    MW: 65854.2 Da    PI: 8.019
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cz07g29070.t1genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA36.47e-12118152135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C+nCg t+T+ WRr +d    +Cn+CG yy+++g+
  Cz07g29070.t1 118 CTNCGITTTSAWRRTKDIRALVCNSCGDYYKRNGR 152
                    ********************************986 PP

2GATA44.12.7e-14207239134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    CsnC++  Tp WRr+  g   LCnaCGlyyr  g
  Cz07g29070.t1 207 CSNCKSRITPTWRRDDGGAL-LCNACGLYYRNVG 239
                    ********************.**********876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    
MRLKAAQCLS RYQVADPPPG PCADGLMVTV DRIECATQYA CLDTFDSEDG MLMAQPQAQH  60
STGWWMYEYP PANGKTNHVT MVNAEPISKP QASYACHEPA PTQTAMVTTQ NTKGIKACTN  120
CGITTTSAWR RTKDIRALVC NSCGDYYKRN GRHRRVKNVA AAQPLPAEQP QQQQVQQPPP  180
QQKQVQGRRT TGPLEQPTVL EALAKACSNC KSRITPTWRR DDGGALLCNA CGLYYRNVGR  240
PRPIHPAPQP EDTAGQQQGK NQQKPATSVQ HIRDKEGVPR QPASKKHRAS KAQNGVIPTD  300
KAASATRLEA HTGDPASAGS CDTSCISLKL NNTGSSSGKL QPPAWEKLKR NVYVSRPAVI  360
QPDDEVPVCC CDASMGQRCR EQDRCLNRLL HVQCTPGYCP ARDACENQVI IKRQRPATKL  420
SFLGDKGWGL VAAQDIPAGT FIAEYTGEVV PCAEGMSRLE QYQAEGLRHT YVMNLNSSEV  480
IDATRRGGIA RFINHSCGPN CETQKWQVRG ELCVCIFTIA DINKDEEITY DYRYESAISS  540
RTKCSCGSAK CTGWLGTTTS ATDACEEDKK DTLFRKVISK VDHDGEVYTV DELDTFDSD*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45170.11e-05GATA family protein