PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cz06g25010.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Chromochloridaceae; Chromochloris
Family GATA
Protein Properties Length: 481aa    MW: 51896.2 Da    PI: 5.3362
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cz06g25010.t1genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.71.2e-16444475132
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                    C++Cgt +Tp WR gp g+ktLCnaCG++y k
  Cz06g25010.t1 444 CTQCGTQSTPVWRAGPHGPKTLCNACGVRYMK 475
                    *****************************976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    
MALEVMRGTS FALYSQFGDR FGGRFHCGCE SLKHLAGNAR EPSEAFQLLP ALSDEMSDPI  60
PCFASELEKE VAELEEEARR DCDFDFNFGL NDDTYKSTAT CQWLGDDTVS LDQRDSSSEH  120
SGVLPSLLPE VVDAIRANAE LVISTGETLK PGAWKGCSKS AECDREDRHR GLCNHRATIP  180
GPMAVAYASQ QLPVDSLTDS FTEQQDEVDK DDTDSVHAET SMEESLSGGH SYNQRPKLED  240
EREVASALKA VTVDDLLPAE RDQLPFRPTA RPALPADRCR VEPIWIQSGN SLSSDQDQYD  300
VSPVYSMDQG APAPLLTVTV PSIHHQPLGS GSSGSPAASM AALQIAPIDF RPLPREQMVN  360
NSLSLPPSSP TAAATSSLPA PMLRPVKPLH LDVHPDVFNM PKLPRVLNKS SKPVSKPSLD  420
GAGSPRGKKR TAGRIAANPN GHCCTQCGTQ STPVWRAGPH GPKTLCNACG VRYMKVAKKK  480
*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.16e-12GATA family protein