PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cz05g08160.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Chromochloridaceae; Chromochloris
Family GATA
Protein Properties Length: 807aa    MW: 89413.1 Da    PI: 7.9449
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cz05g08160.t1genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.11.9e-16742776135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    CsnC+tt+T+lWRr++     LCnaCG+y r +g+
  Cz05g08160.t1 742 CSNCKTTETSLWRRDKVTDLPLCNACGIYMRDHGV 776
                    ****************99999************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    
MDFSHKPLTS WAPEDKQTFL FGVFLFNKDF NLIHMLLPDK QVHDVVSFYY TTFKYSHAHA  60
CWKGLRSVGF QGACLVSGSR QYMTLNRLAQ EAHLSDEQYD VMCSAGQRYH LGQSTLGDLV  120
NSLVSVAGAP ALVKAVPLTE YGVPQEGLSF ELISMSDVLH NIQKSESKIA VFSHLCQEVA  180
AKGWKCDQAN QKSDVTLQSA AQPEISYTAP LMMNYPHPLT FASTKEAVGF LLDQDSQVLV  240
DAVLRFRSQL AQSKLASFMV NEHAIHQECD DTHADATCTI APVSLVTAKG SHKKVPLPGP  300
AQHMCVNCCI DTSRCWRKDK HTGLYLCNAC AVYKRDNGRH RPEALFTTRI THTVKVDDQT  360
PSPRTPQALP PTRFCATPTS AVSAAPTTHN YPFGKAVATS GASSCSPIPK QNELDGMQHT  420
SDHNGLVPST FNQKARLGRM TPLSSWRMNS HDLVAGSQYA AVRPQAFPSG SQYTLQSVLP  480
PDHVDSGEVS DDDDSGWPAV ELMRGTRKPR TKPTRQPKRY KVFQLTAASY EPNQGTHIPD  540
LNHMEDVGVC HVFVNHHNAL NPDYGKDMGT SSSVGSQPWT VSPCQNPEYN MVHDSWAEFR  600
KPVAVGVLQP DNQMVCNSHD VALEALLQQL VTSDSDATEQ AAYDALHNMK YDTFTGISCH  660
RPDMHSTEYR GLEACRGLQH VRYPSRTAFG QPCSPAWTKL GLTDSWSNMC MTRPHGQSNM  720
SLCQDHMVKV RFQRPLRTGK VCSNCKTTET SLWRRDKVTD LPLCNACGIY MRDHGVPRPA  780
PFRSGRYGMV ARKRQRVVYE ASSSPS*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.13e-07GATA family protein